SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mwba3 (5mwb A:496-532)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2230373Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2230991Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2230992Protein automated matches [226968] (4 species)
    not a true protein
  7. 2230993Species Human (Homo sapiens) [TaxId:9606] [225423] (26 PDB entries)
  8. 2292066Domain d5mwba3: 5mwb A:496-532 [335367]
    automated match to d1toza3
    complexed with bgc, ca, fuc, xyp

Details for d5mwba3

PDB Entry: 5mwb (more details), 1.86 Å

PDB Description: human notch-2 egf11-13
PDB Compounds: (A:) Neurogenic locus notch homolog protein 2

SCOPe Domain Sequences for d5mwba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwba3 g.3.11.0 (A:496-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
necqsnpcvnngqcvdkvnrfqclcppgftgpvcqid

SCOPe Domain Coordinates for d5mwba3:

Click to download the PDB-style file with coordinates for d5mwba3.
(The format of our PDB-style files is described here.)

Timeline for d5mwba3:

  • d5mwba3 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15