SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lrca_ (5lrc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142110Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 2142145Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (73 PDB entries)
    Uniprot P00489 ! Uniprot P00489
  8. 2292060Domain d5lrca_: 5lrc A: [335361]
    automated match to d2gpaa_
    complexed with 73e, plp

Details for d5lrca_

PDB Entry: 5lrc (more details), 2 Å

PDB Description: crystal structure of glycogen phosphorylase in complex with ks114
PDB Compounds: (A:) Glycogen phosphorylase, muscle form

SCOPe Domain Sequences for d5lrca_:

Sequence, based on SEQRES records: (download)

>d5lrca_ c.87.1.4 (A:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa

Sequence, based on observed residues (ATOM records): (download)

>d5lrca_ c.87.1.4 (A:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnf
dafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealer
wpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlci
agshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaer
igeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvq
vkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitai
gdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlnga
ltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqls
sgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirnia
tsgkfssdrtiaqyareiwgvepsrqrlpa

SCOPe Domain Coordinates for d5lrca_:

Click to download the PDB-style file with coordinates for d5lrca_.
(The format of our PDB-style files is described here.)

Timeline for d5lrca_:

  • d5lrca_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15