SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l6jb_ (5l6j B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158454Protein Ubiquitin [54238] (8 species)
  7. 2292057Species Saccharomyces cerevisiae [TaxId:559292] [335358] (1 PDB entry)
  8. 2292058Domain d5l6jb_: 5l6j B: [335359]
    automated match to d1otrb_
    complexed with 61t, cl, gol, so4

Details for d5l6jb_

PDB Entry: 5l6j (more details), 2.68 Å

PDB Description: uba1 in complex with ub-mln7243 covalent adduct
PDB Compounds: (B:) Ubiquitin-40S ribosomal protein S31

SCOPe Domain Sequences for d5l6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6jb_ d.15.1.1 (B:) Ubiquitin {Saccharomyces cerevisiae [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5l6jb_:

Click to download the PDB-style file with coordinates for d5l6jb_.
(The format of our PDB-style files is described here.)

Timeline for d5l6jb_:

  • d5l6jb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15