Lineage for d5h0wa1 (5h0w A:11-124)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365078Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2365079Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2365080Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2365101Species Human (Homo sapiens) [TaxId:9606] [49475] (285 PDB entries)
    Uniprot P02766 31-143
  8. 2365631Domain d5h0wa1: 5h0w A:11-124 [335343]
    Other proteins in same PDB: d5h0wa2
    automated match to d5ezpe_
    complexed with so4

Details for d5h0wa1

PDB Entry: 5h0w (more details), 1.9 Å

PDB Description: crystal structure of h88f mutated human transthyretin
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d5h0wa1:

Sequence, based on SEQRES records: (download)

>d5h0wa1 b.3.4.1 (A:11-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispffehaevvftandsgprrytiaallspysysttavvtn

Sequence, based on observed residues (ATOM records): (download)

>d5h0wa1 b.3.4.1 (A:11-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispffehaevvftanprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d5h0wa1:

Click to download the PDB-style file with coordinates for d5h0wa1.
(The format of our PDB-style files is described here.)

Timeline for d5h0wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h0wa2