Lineage for d5h0vb1 (5h0v B:11-124)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035041Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2035609Protein automated matches [190376] (1 species)
    not a true protein
  7. 2035610Species Human (Homo sapiens) [TaxId:9606] [187223] (17 PDB entries)
  8. 2292036Domain d5h0vb1: 5h0v B:11-124 [335337]
    Other proteins in same PDB: d5h0va2, d5h0vb2, d5h0vc2, d5h0vd2
    automated match to d5ezpe_
    complexed with mg, mpd

Details for d5h0vb1

PDB Entry: 5h0v (more details), 1.58 Å

PDB Description: crystal structure of h88a mutated human transthyretin
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5h0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0vb1 b.3.4.1 (B:11-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d5h0vb1:

Click to download the PDB-style file with coordinates for d5h0vb1.
(The format of our PDB-style files is described here.)

Timeline for d5h0vb1:

  • d5h0vb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15