SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b61d_ (5b61 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (48 PDB entries)
  8. 2292035Domain d5b61d_: 5b61 D: [335336]
    automated match to d3st2a_

Details for d5b61d_

PDB Entry: 5b61 (more details), 3.12 Å

PDB Description: extra-superfolder gfp
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d5b61d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b61d_ d.22.1.1 (D:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvrgegegdatngkitlklicttgklpvpwptlvtt
cgygvqcfarypdhmkrhdffksampegyvqertisfkddgtfktraevkfegdtivnri
klkgidfkedgnilghkleynfnshkvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvrlpdnhylstqsviledpnekrdhmvlhefvtaagit

SCOPe Domain Coordinates for d5b61d_:

Click to download the PDB-style file with coordinates for d5b61d_.
(The format of our PDB-style files is described here.)

Timeline for d5b61d_:

  • d5b61d_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15