SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b7sb1 (5b7s B:1-397)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (118 species)
    not a true protein
  7. 2292025Species Thermococcus onnurineus [TaxId:523850] [335326] (4 PDB entries)
  8. 2292031Domain d5b7sb1: 5b7s B:1-397 [335332]
    Other proteins in same PDB: d5b7sa2, d5b7sb2
    automated match to d1jf9a_
    complexed with gol

Details for d5b7sb1

PDB Entry: 5b7s (more details), 2.58 Å

PDB Description: apo structure of cysteine desulfurase from thermococcus onnurineus na1
PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d5b7sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b7sb1 c.67.1.0 (B:1-397) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqmath
kyeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdllp
wqrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgkia
kdegaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfepp
ligggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehklv
krttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpv
mkklgingtvrasfhvynsleevetflgvmeelvkgl

SCOPe Domain Coordinates for d5b7sb1:

Click to download the PDB-style file with coordinates for d5b7sb1.
(The format of our PDB-style files is described here.)

Timeline for d5b7sb1:

  • d5b7sb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5b7sb2