SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b87a_ (5b87 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (118 species)
    not a true protein
  7. 2292025Species Thermococcus onnurineus [TaxId:523850] [335326] (4 PDB entries)
  8. 2292028Domain d5b87a_: 5b87 A: [335329]
    automated match to d1jf9a_
    complexed with ala, plp

Details for d5b87a_

PDB Entry: 5b87 (more details), 2.28 Å

PDB Description: crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d5b87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b87a_ c.67.1.0 (A:) automated matches {Thermococcus onnurineus [TaxId: 523850]}
ripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqmathk
yeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdllpw
qrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgkiak
degaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfeppl
igggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehklvk
rttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpvm
kklgingtvrasfhvynsleevetflgvmeelvkglk

SCOPe Domain Coordinates for d5b87a_:

Click to download the PDB-style file with coordinates for d5b87a_.
(The format of our PDB-style files is described here.)

Timeline for d5b87a_:

  • d5b87a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15