Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Thermococcus onnurineus [TaxId:523850] [335326] (4 PDB entries) |
Domain d5b87a_: 5b87 A: [335329] Other proteins in same PDB: d5b87b2 automated match to d1jf9a_ complexed with ala, plp |
PDB Entry: 5b87 (more details), 2.28 Å
SCOPe Domain Sequences for d5b87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b87a_ c.67.1.0 (A:) automated matches {Thermococcus onnurineus [TaxId: 523850]} ripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqmathk yeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdllpw qrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgkiak degaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfeppl igggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehklvk rttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpvm kklgingtvrasfhvynsleevetflgvmeelvkglk
Timeline for d5b87a_: