Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (54 PDB entries) |
Domain d5b61a_: 5b61 A: [335325] automated match to d3st2a_ |
PDB Entry: 5b61 (more details), 3.12 Å
SCOPe Domain Sequences for d5b61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b61a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} ftgvvpilveldgdvnghkfsvrgegegdatngkitlklicttgklpvpwptlvttcgyg vqcfarypdhmkrhdffksampegyvqertisfkddgtfktraevkfegdtivnriklkg idfkedgnilghkleynfnshkvyitadkqkngikanfkirhnvedgsvqladhyqqntp igdgpvrlpdnhylstqsviledpnekrdhmvlhefvtaagi
Timeline for d5b61a_: