SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tuxa1 (5tux A:3-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014191Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2014192Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2014193Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 protein domains)
  6. 2014198Protein automated matches [227037] (2 species)
    not a true protein
  7. 2014199Species Synechocystis sp. [TaxId:1111708] [275030] (4 PDB entries)
  8. 2292021Domain d5tuxa1: 5tux A:3-173 [335322]
    Other proteins in same PDB: d5tuxa2
    automated match to d1m98a1
    complexed with ech, gol

Details for d5tuxa1

PDB Entry: 5tux (more details), 1.5 Å

PDB Description: crystal structure and light induced structural changes in orange carotenoid protein bound with echinenone
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuxa1:

Sequence, based on SEQRES records: (download)

>d5tuxa1 a.175.1.1 (A:3-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d5tuxa1 a.175.1.1 (A:3-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftkria

SCOPe Domain Coordinates for d5tuxa1:

Click to download the PDB-style file with coordinates for d5tuxa1.
(The format of our PDB-style files is described here.)

Timeline for d5tuxa1:

  • d5tuxa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5tuxa2