Lineage for d5gudf1 (5gud F:1-197)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143399Species Corynebacterium glutamicum [TaxId:1718] [335048] (1 PDB entry)
  8. 2143404Domain d5gudf1: 5gud F:1-197 [335312]
    Other proteins in same PDB: d5guda2, d5gudb2, d5gudc2, d5gudd2, d5gudf2
    automated match to d3r3ja1
    complexed with 2it, cit, k, ndp

Details for d5gudf1

PDB Entry: 5gud (more details), 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d5gudf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gudf1 c.58.1.0 (F:1-197) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
ghyrrmanqhesgvltg

SCOPe Domain Coordinates for d5gudf1:

Click to download the PDB-style file with coordinates for d5gudf1.
(The format of our PDB-style files is described here.)

Timeline for d5gudf1: