SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gudc2 (5gud C:198-447)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2094783Species Corynebacterium glutamicum [TaxId:1718] [188585] (2 PDB entries)
  8. 2292006Domain d5gudc2: 5gud C:198-447 [335307]
    Other proteins in same PDB: d5guda1, d5gudb1, d5gudc1, d5gudd1, d5gudf1
    automated match to d3r3ja2
    complexed with 2it, cit, k, ndp

Details for d5gudc2

PDB Entry: 5gud (more details), 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d5gudc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gudc2 c.2.1.0 (C:198-447) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga
tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdia
lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva
tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv
adamlaqgvi

SCOPe Domain Coordinates for d5gudc2:

Click to download the PDB-style file with coordinates for d5gudc2.
(The format of our PDB-style files is described here.)

Timeline for d5gudc2:

  • d5gudc2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08