Lineage for d5x8sa_ (5x8s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2291944Species Nomascus leucogenys [TaxId:61853] [335245] (4 PDB entries)
  8. 2291998Domain d5x8sa_: 5x8s A: [335299]
    automated match to d3l0la_
    complexed with 6q5; mutant

Details for d5x8sa_

PDB Entry: 5x8s (more details), 2.2 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain with ursolic acid.
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5x8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8sa_ a.123.1.0 (A:) automated matches {Nomascus leucogenys [TaxId: 61853]}
pyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaa

SCOPe Domain Coordinates for d5x8sa_:

Click to download the PDB-style file with coordinates for d5x8sa_.
(The format of our PDB-style files is described here.)

Timeline for d5x8sa_:

  • d5x8sa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08