Lineage for d3wmmw_ (3wmm W:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251247Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2251248Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2251302Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2251303Protein automated matches [254444] (2 species)
    not a true protein
  7. 2251306Species Thermochromatium tepidum [TaxId:1050] [267909] (3 PDB entries)
  8. 2251335Domain d3wmmw_: 3wmm W: [335298]
    automated match to d3wmn5_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmw_

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (W:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmmw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmw_ f.3.1.0 (W:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk

SCOPe Domain Coordinates for d3wmmw_:

Click to download the PDB-style file with coordinates for d3wmmw_.
(The format of our PDB-style files is described here.)

Timeline for d3wmmw_: