SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1qa_ (5k1q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (19 species)
    not a true protein
  7. 2080599Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries)
  8. 2291996Domain d5k1qa_: 5k1q A: [335297]
    automated match to d3kruc_
    complexed with fmn, pcr

Details for d5k1qa_

PDB Entry: 5k1q (more details), 1.55 Å

PDB Description: crystal structure of oxidized shewanella yellow enzyme 4 (sye4) in complex with p-methylphenol
PDB Compounds: (A:) NAD(P)H:flavin oxidoreductase Sye4

SCOPe Domain Sequences for d5k1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1qa_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
svenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagliiseati
irpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphffgggdvla
psaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgveihgangyl
idqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayfnmasdsr
drvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgvgsysaet
askaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli

SCOPe Domain Coordinates for d5k1qa_:

Click to download the PDB-style file with coordinates for d5k1qa_.
(The format of our PDB-style files is described here.)

Timeline for d5k1qa_:

  • d5k1qa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08