Lineage for d5vfda_ (5vfd A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (43 species)
    not a true protein
  7. 2569662Species Acinetobacter baumannii [TaxId:470] [194613] (47 PDB entries)
  8. 2569718Domain d5vfda_: 5vfd A: [335292]
    automated match to d3g4pa_
    complexed with 9cm, 9cp, so4

Details for d5vfda_

PDB Entry: 5vfd (more details), 1.93 Å

PDB Description: diazabicyclooctenone etx2514 bound to class d beta lactamase oxa-24 from a. baumannii
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5vfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfda_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

SCOPe Domain Coordinates for d5vfda_:

Click to download the PDB-style file with coordinates for d5vfda_.
(The format of our PDB-style files is described here.)

Timeline for d5vfda_: