SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vfda_ (5vfd A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (39 species)
    not a true protein
  7. 2218833Species Acinetobacter baumannii [TaxId:470] [194613] (38 PDB entries)
  8. 2291991Domain d5vfda_: 5vfd A: [335292]
    automated match to d3g4pa_
    complexed with 9cm, 9cp, so4

Details for d5vfda_

PDB Entry: 5vfd (more details), 1.93 Å

PDB Description: diazabicyclooctenone etx2514 bound to class d beta lactamase oxa-24 from a. baumannii
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5vfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfda_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

SCOPe Domain Coordinates for d5vfda_:

Click to download the PDB-style file with coordinates for d5vfda_.
(The format of our PDB-style files is described here.)

Timeline for d5vfda_:

  • d5vfda_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08