Lineage for d5x8fd_ (5x8f D:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (23 species)
    not a true protein
  7. 2222641Species Bacillus subtilis [TaxId:224308] [276264] (5 PDB entries)
  8. 2291987Domain d5x8fd_: 5x8f D: [335288]
    automated match to d5buqb_
    complexed with amp, ca, mg, na, peg, s0n; mutant

Details for d5x8fd_

PDB Entry: 5x8f (more details), 1.76 Å

PDB Description: ternary complex structure of a double mutant i454ra456k of o- succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom
PDB Compounds: (D:) 2-succinylbenzoate--CoA ligase

SCOPe Domain Sequences for d5x8fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8fd_ e.23.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 224308]}
lteqpnwlmqraqltperialiyedqtvtfaelfaaskrmaeqlaahsvrkgdtaaillq
nraemvyavhacfllgvkavllntklstherlfqledsgsgflltdssfekkeyehivqt
idvdelmkeaaeeieieaymqmdatatlmytsgttgkpkgvqqtfgnhyfsavssalnlg
iteqdrwlialplfhisglsalfksviygmtvvlhqrfsvsdvlhsinrhevtmisavqt
mlaslleetnrcpesircillgggpaplplleecrekgfpvfqsygmtetcsqivtlspe
fsmeklgsagkplfsceikierdgqvcepyehgeimvkgpnvmksyfnresaneasfqng
wlktgdlgyldnegflyvldrrsdliisggeniypaevesvllshpavaeagvsgaedkk
wgkvphaylvlhkpvsageltdyckerlakykrpkkffvldrlprnasnkllrnqlkdar
kgel

SCOPe Domain Coordinates for d5x8fd_:

Click to download the PDB-style file with coordinates for d5x8fd_.
(The format of our PDB-style files is described here.)

Timeline for d5x8fd_:

  • d5x8fd_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08