Lineage for d5ulha1 (5ulh A:1-147)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164354Species Human (Homo sapiens) [TaxId:9606] [186848] (45 PDB entries)
  8. 2291985Domain d5ulha1: 5ulh A:1-147 [335286]
    Other proteins in same PDB: d5ulha2, d5ulhb_
    automated match to d2clwa_
    complexed with gol, scn, zn

Details for d5ulha1

PDB Entry: 5ulh (more details), 1.95 Å

PDB Description: structure of rnf165 in complex with a ubch5b~ub conjugate
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5ulha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulha1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5ulha1:

Click to download the PDB-style file with coordinates for d5ulha1.
(The format of our PDB-style files is described here.)

Timeline for d5ulha1:

  • d5ulha1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ulha2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ulhb_