SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x8xc_ (5x8x C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2291944Species Nomascus leucogenys [TaxId:61853] [335245] (4 PDB entries)
  8. 2291982Domain d5x8xc_: 5x8x C: [335283]
    automated match to d3l0la_
    complexed with 82o; mutant

Details for d5x8xc_

PDB Entry: 5x8x (more details), 2.6 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain with compound a.
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d5x8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8xc_ a.123.1.0 (C:) automated matches {Nomascus leucogenys [TaxId: 61853]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv

SCOPe Domain Coordinates for d5x8xc_:

Click to download the PDB-style file with coordinates for d5x8xc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8xc_:

  • d5x8xc_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08