Lineage for d5tuwe1 (5tuw E:3-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018233Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2018234Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2018235Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 2018242Protein automated matches [227037] (2 species)
    not a true protein
  7. 2018243Species Synechocystis sp. [TaxId:1111708] [275030] (4 PDB entries)
  8. 2018251Domain d5tuwe1: 5tuw E:3-173 [335279]
    Other proteins in same PDB: d5tuwa2, d5tuwb2, d5tuwc2, d5tuwd2, d5tuwe2, d5tuwf2
    automated match to d1m98a1
    complexed with eq3, gol

Details for d5tuwe1

PDB Entry: 5tuw (more details), 2.3 Å

PDB Description: crystal structure of orange carotenoid protein with partial loss of 3'oh echinenone chromophore
PDB Compounds: (E:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuwe1:

Sequence, based on SEQRES records: (download)

>d5tuwe1 a.175.1.1 (E:3-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d5tuwe1 a.175.1.1 (E:3-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftgkria

SCOPe Domain Coordinates for d5tuwe1:

Click to download the PDB-style file with coordinates for d5tuwe1.
(The format of our PDB-style files is described here.)

Timeline for d5tuwe1: