SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uora_ (5uor A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (808 PDB entries)
  8. 2291977Domain d5uora_: 5uor A: [335278]
    automated match to d2clqa_
    complexed with 8gv, so4

Details for d5uora_

PDB Entry: 5uor (more details), 2.75 Å

PDB Description: structure-based design of ask1 inhibitors as potential first-in-class agents for heart failure
PDB Compounds: (A:) mitogen-activated protein kinase kinase kinase 5

SCOPe Domain Sequences for d5uora_:

Sequence, based on SEQRES records: (download)

>d5uora_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperdsrysqplheeialhk
hlkhknivqylgsfsengfikifmeqvpggslsallrskwgplkdneqtigfytkqileg
lkylhdnqivhrdikgdnvlintysgvlkisdfgtskrlaginpctetftgtlqymapei
idkgprgygkaadiwslgctiiematgkppfyelgepqaamfkvgmfkvhpeipesmsae
akafilkcfepdpdkracandllvdeflk

Sequence, based on observed residues (ATOM records): (download)

>d5uora_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperdsrysqplheeialhk
hlkhknivqylgsfsengfikifmeqvpggslsallrskwgplkdneqtigfytkqileg
lkylhdnqivhrdikgdnvlintysgvlkisdfgtskrlftgtlqymapeiidygkaadi
wslgctiiematgkppfyeamfkvgmfkvhpeipesmsaeakafilkcfepdpdkracan
dllvdeflk

SCOPe Domain Coordinates for d5uora_:

Click to download the PDB-style file with coordinates for d5uora_.
(The format of our PDB-style files is described here.)

Timeline for d5uora_:

  • d5uora_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08