SCOPe 2.06: Domain d5x8wa_: 5x8w A:

Lineage for d5x8wa_ (5x8w A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Nomascus leucogenys [TaxId:61853] [335245] (4 PDB entries)

8. Domain d5x8wa_: 5x8w A: [335276]
   automated match to d3l0la_
   mutant

Details for d5x8wa_

PDB Entry: 5x8w, 2.3 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain.

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5x8wa_:

Sequence; same for both SEQRES and ATOM records:

>d5x8wa_ a.123.1.0 (A:) automated matches {Nomascus leucogenys [TaxId: 61853]}
yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpplyk
elfs

Timeline for d5x8wa_:

• d5x8wa_ is new in SCOPe 2.06-stable
  
• d5x8wa_ appears in SCOPe 2.07
  
• d5x8wa_ appears in the current release, SCOPe 2.08