SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ulka_ (5ulk A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164354Species Human (Homo sapiens) [TaxId:9606] [186848] (44 PDB entries)
  8. 2291973Domain d5ulka_: 5ulk A: [335274]
    Other proteins in same PDB: d5ulkb_
    automated match to d2clwa_
    complexed with zn

Details for d5ulka_

PDB Entry: 5ulk (more details), 2.38 Å

PDB Description: crystal structure of rnf165 in complex with a ubch5b~ub conjugate
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5ulka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulka_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5ulka_:

Click to download the PDB-style file with coordinates for d5ulka_.
(The format of our PDB-style files is described here.)

Timeline for d5ulka_:

  • d5ulka_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08