SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vo7a_ (5vo7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (163 species)
    not a true protein
  7. 2291968Species Mycobacterium smegmatis [TaxId:1772] [335269] (1 PDB entry)
  8. 2291969Domain d5vo7a_: 5vo7 A: [335270]
    automated match to d2l4qa_

Details for d5vo7a_

PDB Entry: 5vo7 (more details)

PDB Description: nmr assignment and structure of thioredoxin (rv1471 ortholog) from mycobacterium smegmatis atcc 700084 / mc(2)155
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5vo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vo7a_ c.47.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
msedsatvavtddsfstdvlgsskpvlvdfwatwcgpckmvapvleeiaaekgdqltvak
idvdanpatardfqvvsiptmilfkdgapvkrivgakgkaallrelsdal

SCOPe Domain Coordinates for d5vo7a_:

Click to download the PDB-style file with coordinates for d5vo7a_.
(The format of our PDB-style files is described here.)

Timeline for d5vo7a_:

  • d5vo7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08