Lineage for d5vo7a_ (5vo7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2291968Species Mycobacterium smegmatis [TaxId:1772] [335269] (1 PDB entry)
  8. 2291969Domain d5vo7a_: 5vo7 A: [335270]
    automated match to d2l4qa_

Details for d5vo7a_

PDB Entry: 5vo7 (more details)

PDB Description: nmr assignment and structure of thioredoxin (rv1471 ortholog) from mycobacterium smegmatis atcc 700084 / mc(2)155
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5vo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vo7a_ c.47.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
msedsatvavtddsfstdvlgsskpvlvdfwatwcgpckmvapvleeiaaekgdqltvak
idvdanpatardfqvvsiptmilfkdgapvkrivgakgkaallrelsdal

SCOPe Domain Coordinates for d5vo7a_:

Click to download the PDB-style file with coordinates for d5vo7a_.
(The format of our PDB-style files is described here.)

Timeline for d5vo7a_:

  • d5vo7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08