SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x8qc_ (5x8q C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (46 PDB entries)
  8. 2291966Domain d5x8qc_: 5x8q C: [335267]
    automated match to d3l0la_
    complexed with 82r; mutant

Details for d5x8qc_

PDB Entry: 5x8q (more details), 2.2 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain with rockogenin.
PDB Compounds: (C:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5x8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8qc_ a.123.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv

SCOPe Domain Coordinates for d5x8qc_:

Click to download the PDB-style file with coordinates for d5x8qc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8qc_:

  • d5x8qc_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08