Lineage for d5vaab2 (5vaa B:342-442)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (563 PDB entries)
  8. 2291965Domain d5vaab2: 5vaa B:342-442 [335266]
    automated match to d1igyb4
    complexed with bma, fuc, gal, gol, man, mes, nag; mutant

Details for d5vaab2

PDB Entry: 5vaa (more details), 1.55 Å

PDB Description: crystal structure of mouse igg2a fc t370k mutant
PDB Compounds: (B:) ig gamma-2a chain c region, a allele

SCOPe Domain Sequences for d5vaab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vaab2 b.1.1.0 (B:342-442) automated matches {Mus musculus [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvkdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfs

SCOPe Domain Coordinates for d5vaab2:

Click to download the PDB-style file with coordinates for d5vaab2.
(The format of our PDB-style files is described here.)

Timeline for d5vaab2:

  • d5vaab2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5vaab1