Lineage for d5vwsa_ (5vws A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (61 species)
    not a true protein
  7. 2291960Species Thermobispora bispora [TaxId:469371] [335261] (1 PDB entry)
  8. 2291961Domain d5vwsa_: 5vws A: [335262]
    automated match to d2jjpa_
    complexed with hem

Details for d5vwsa_

PDB Entry: 5vws (more details), 2.41 Å

PDB Description: ligand free structure of cytochrome p450 tbtj1
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5vwsa_:

Sequence, based on SEQRES records: (download)

>d5vwsa_ a.104.1.0 (A:) automated matches {Thermobispora bispora [TaxId: 469371]}
gqpsltdggaalfawlrtmrnehpvwrdqfgiyhvfryddvrqilgdyqtfssdrtrlmp
taqgfgkggitmidppehrhqrrlithaftpqsisameprirqiadhlldelpgpefdlv
ehfayplpviviaellgvppgdrhlfrtwsdrlmslqvenyadpelartvaaamtemndy
lrehcrsrrthprddlltrlvqaevegkrldleevvntasllllaghltttvligntmlc
lwdhpeaekavradpslipaaleeslrlrspflqagrvttrdvtiagetipanrfvmawi
lsanhddrrfpdperfdlhrqttghiafghgvhfclgaqlgrlegrialerllgrfteih
pwpregisfyqsaifgasrmpvrcg

Sequence, based on observed residues (ATOM records): (download)

>d5vwsa_ a.104.1.0 (A:) automated matches {Thermobispora bispora [TaxId: 469371]}
gqpsltdggaalfawlrtmrnehpvwrdqfgiyhvfryddvrqilgdyqtfssdrtrlgk
ggitmidppehrhqrrlithaftpqsisameprirqiadhlldelpgpefdlvehfaypl
pviviaellgvppgdrhlfrtwsdrlmslqveadpelartvaaamtemndylrehcrsrr
thprddlltrlvqaevegkrldleevvntasllllaghltttvligntmlclwdhpeaek
avradpslipaaleeslrlrspflqagrvttrdvtiagetipanrfvmawilsanhddrr
fpdperfdlhrqttghiafghgvhfclgaqlgrlegrialerllgrfteihpwpregisf
yqsaifgasrmpvrcg

SCOPe Domain Coordinates for d5vwsa_:

Click to download the PDB-style file with coordinates for d5vwsa_.
(The format of our PDB-style files is described here.)

Timeline for d5vwsa_:

  • d5vwsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08