SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vwsa_ (5vws A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (59 species)
    not a true protein
  7. 2291960Species Thermobispora bispora [TaxId:469371] [335261] (1 PDB entry)
  8. 2291961Domain d5vwsa_: 5vws A: [335262]
    automated match to d2jjpa_
    complexed with hem

Details for d5vwsa_

PDB Entry: 5vws (more details), 2.41 Å

PDB Description: ligand free structure of cytochrome p450 tbtj1
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5vwsa_:

Sequence, based on SEQRES records: (download)

>d5vwsa_ a.104.1.0 (A:) automated matches {Thermobispora bispora [TaxId: 469371]}
gqpsltdggaalfawlrtmrnehpvwrdqfgiyhvfryddvrqilgdyqtfssdrtrlmp
taqgfgkggitmidppehrhqrrlithaftpqsisameprirqiadhlldelpgpefdlv
ehfayplpviviaellgvppgdrhlfrtwsdrlmslqvenyadpelartvaaamtemndy
lrehcrsrrthprddlltrlvqaevegkrldleevvntasllllaghltttvligntmlc
lwdhpeaekavradpslipaaleeslrlrspflqagrvttrdvtiagetipanrfvmawi
lsanhddrrfpdperfdlhrqttghiafghgvhfclgaqlgrlegrialerllgrfteih
pwpregisfyqsaifgasrmpvrcg

Sequence, based on observed residues (ATOM records): (download)

>d5vwsa_ a.104.1.0 (A:) automated matches {Thermobispora bispora [TaxId: 469371]}
gqpsltdggaalfawlrtmrnehpvwrdqfgiyhvfryddvrqilgdyqtfssdrtrlgk
ggitmidppehrhqrrlithaftpqsisameprirqiadhlldelpgpefdlvehfaypl
pviviaellgvppgdrhlfrtwsdrlmslqveadpelartvaaamtemndylrehcrsrr
thprddlltrlvqaevegkrldleevvntasllllaghltttvligntmlclwdhpeaek
avradpslipaaleeslrlrspflqagrvttrdvtiagetipanrfvmawilsanhddrr
fpdperfdlhrqttghiafghgvhfclgaqlgrlegrialerllgrfteihpwpregisf
yqsaifgasrmpvrcg

SCOPe Domain Coordinates for d5vwsa_:

Click to download the PDB-style file with coordinates for d5vwsa_.
(The format of our PDB-style files is described here.)

Timeline for d5vwsa_:

  • d5vwsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08