SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kb5a_ (5kb5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137473Family c.72.1.1: Ribokinase-like [53614] (10 protein domains)
    automatically mapped to Pfam PF00294
  6. 2137495Protein Adenosine kinase [53617] (3 species)
  7. 2291749Species Mus musculus [TaxId:10090] [335051] (2 PDB entries)
  8. 2291955Domain d5kb5a_: 5kb5 A: [335256]
    automated match to d4o1lb_
    complexed with adn, adp, cl, k, mg, pg4, po4

Details for d5kb5a_

PDB Entry: 5kb5 (more details), 1.8 Å

PDB Description: crystal structure of the adenosine kinase from mus musculus in complex with adenosine and adenosine-diphosphate
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d5kb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kb5a_ c.72.1.1 (A:) Adenosine kinase {Mus musculus [TaxId: 10090]}
lsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgtc
aacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkva
ryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdike
iakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdafv
ggflsqlvsdkplteciraghyaasviirrtgctfpekpdf

SCOPe Domain Coordinates for d5kb5a_:

Click to download the PDB-style file with coordinates for d5kb5a_.
(The format of our PDB-style files is described here.)

Timeline for d5kb5a_:

  • d5kb5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08