SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v4lc_ (5v4l C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (19 species)
    not a true protein
  7. 2291887Species Cryptococcus neoformans [TaxId:5207] [335188] (1 PDB entry)
  8. 2291954Domain d5v4lc_: 5v4l C: [335255]
    automated match to d2vd6b_

Details for d5v4lc_

PDB Entry: 5v4l (more details), 2.1 Å

PDB Description: cryptococcus neoformans adenylosuccinate lyase
PDB Compounds: (C:) adenylosuccinate lyase

SCOPe Domain Sequences for d5v4lc_:

Sequence, based on SEQRES records: (download)

>d5v4lc_ a.127.1.0 (C:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
mdsyqtplssryaskemsklfssgarfgtwrklwlnlaiaekelglaisdaaieqmkanl
eldeaqmkvaaeeekkrrhdvmahvhtfgtvapeaagiihlgatscyvtdnadliflrdg
ldillpklatvisrlanfakqyrdlptlgfthfqpaqlttvgkratlwiqellwdlrnlq
rarddlgfrgvkgttgtqasflalfdgdhakvealdkrvtelfgfpyaypvtgqtysrki
dadvlgplssfgatvhkiatdirllanlkeieepfekdqigssamaykrnpmrceracsl
arhlmaiyqntlmtssvqwlertlddsanrrvtipeafltadillttlqniseglvvypr
vigrrisqelpfmateniimaivkaggdrqechekirvlshqagavvkeeggendlidrv
kndeyfkpiwgqldalldprtfvgrapeqvdgflkewvepalkpyeeal

Sequence, based on observed residues (ATOM records): (download)

>d5v4lc_ a.127.1.0 (C:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
mdsyqtplssaskemsklfssgarfgtwrklwlnlaiaekelglaisdaaieqmkanlel
deaqmkvaaeeekkrrhdvmahvhtfgtvapeaagiihlgatscyvtdnadliflrdgld
illpklatvisrlanfakqyrdlptlgfthfqpaqlttvgkratlwiqellwdlrnlqra
rddlgfrgvkgttgtqasflalfdgdhakvealdkrvtelfgfpyaypvtgqtysrkida
dvlgplssfgatvhkiatdirllanlkeieepfekdqigssamaykrnpmrceracslar
hlmaiyqntlmtssvqwlertlddsanrrvtipeafltadillttlqniseglvvyprvi
grrisqelpfmateniimaivkaggdrqechekirvlshqagavvkeeggendlidrvkn
deyfkpiwgqldalldprtfvgrapeqvdgflkewvepalkpyeeal

SCOPe Domain Coordinates for d5v4lc_:

Click to download the PDB-style file with coordinates for d5v4lc_.
(The format of our PDB-style files is described here.)

Timeline for d5v4lc_:

  • d5v4lc_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08