SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kbxa_ (5kbx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987880Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 1987888Family a.24.10.2: Phosphorelay protein-like [47230] (3 protein domains)
  6. 1987901Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2291951Species Saccharomyces cerevisiae [TaxId:559292] [335252] (1 PDB entry)
  8. 2291952Domain d5kbxa_: 5kbx A: [335253]
    Other proteins in same PDB: d5kbxb_
    automated match to d2r25a_
    complexed with gol, po4

Details for d5kbxa_

PDB Entry: 5kbx (more details), 2.8 Å

PDB Description: co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1
PDB Compounds: (A:) Phosphorelay intermediate protein YPD1

SCOPe Domain Sequences for d5kbxa_:

Sequence, based on SEQRES records: (download)

>d5kbxa_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Saccharomyces cerevisiae [TaxId: 559292]}
tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedde
eikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Sequence, based on observed residues (ATOM records): (download)

>d5kbxa_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Saccharomyces cerevisiae [TaxId: 559292]}
tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginikdens
iyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d5kbxa_:

Click to download the PDB-style file with coordinates for d5kbxa_.
(The format of our PDB-style files is described here.)

Timeline for d5kbxa_:

  • d5kbxa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08