SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wmms_ (3wmm S:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224181Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2224182Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2224236Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2224237Protein automated matches [254444] (2 species)
    not a true protein
  7. 2224240Species Thermochromatium tepidum [TaxId:1050] [267909] (3 PDB entries)
  8. 2291948Domain d3wmms_: 3wmm S: [335249]
    automated match to d3wmn5_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmms_

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (S:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmms_ f.3.1.0 (S:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk

SCOPe Domain Coordinates for d3wmms_:

Click to download the PDB-style file with coordinates for d3wmms_.
(The format of our PDB-style files is described here.)

Timeline for d3wmms_:

  • d3wmms_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08