SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x8fc_ (5x8f C:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2222641Species Bacillus subtilis [TaxId:224308] [276264] (5 PDB entries)
  8. 2291947Domain d5x8fc_: 5x8f C: [335248]
    automated match to d5buqb_
    complexed with amp, ca, mg, na, peg, s0n; mutant

Details for d5x8fc_

PDB Entry: 5x8f (more details), 1.76 Å

PDB Description: ternary complex structure of a double mutant i454ra456k of o- succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom
PDB Compounds: (C:) 2-succinylbenzoate--CoA ligase

SCOPe Domain Sequences for d5x8fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8fc_ e.23.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
lteqpnwlmqraqltperialiyedqtvtfaelfaaskrmaeqlaahsvrkgdtaaillq
nraemvyavhacfllgvkavllntklstherlfqledsgsgflltdssfekkeyehivqt
idvdelmkeaaeeieieaymqmdatatlmytsgttgkpkgvqqtfgnhyfsavssalnlg
iteqdrwlialplfhisglsalfksviygmtvvlhqrfsvsdvlhsinrhevtmisavqt
mlaslleetnrcpesircillgggpaplplleecrekgfpvfqsygmtetcsqivtlspe
fsmeklgsagkplfsceikierdgqvcepyehgeimvkgpnvmksyfnresaneasfqng
wlktgdlgyldnegflyvldrrsdliisggeniypaevesvllshpavaeagvsgaedkk
wgkvphaylvlhkpvsageltdyckerlakykrpkkffvldrlprnasnkllrnqlkdar
kgell

SCOPe Domain Coordinates for d5x8fc_:

Click to download the PDB-style file with coordinates for d5x8fc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8fc_:

  • d5x8fc_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08