Lineage for d5nqqa2 (5nqq A:160-331)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2206815Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 protein domains)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2207162Protein automated matches [226882] (7 species)
    not a true protein
  7. 2207285Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (8 PDB entries)
  8. 2291941Domain d5nqqa2: 5nqq A:160-331 [335242]
    Other proteins in same PDB: d5nqqa1, d5nqqb1, d5nqqc1, d5nqqd1
    automated match to d4i9ha2
    complexed with nai, oaa, so4

Details for d5nqqa2

PDB Entry: 5nqq (more details), 1.87 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqqa2 d.162.1.1 (A:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5nqqa2:

Click to download the PDB-style file with coordinates for d5nqqa2.
(The format of our PDB-style files is described here.)

Timeline for d5nqqa2:

  • d5nqqa2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08