Lineage for d5nqqa1 (5nqq A:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093432Protein automated matches [226881] (5 species)
    not a true protein
  7. 2093485Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (8 PDB entries)
  8. 2291940Domain d5nqqa1: 5nqq A:1-159 [335241]
    Other proteins in same PDB: d5nqqa2, d5nqqb2, d5nqqc2, d5nqqd2
    automated match to d4i9ha1
    complexed with nai, oaa, so4

Details for d5nqqa1

PDB Entry: 5nqq (more details), 1.87 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqqa1 c.2.1.5 (A:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5nqqa1:

Click to download the PDB-style file with coordinates for d5nqqa1.
(The format of our PDB-style files is described here.)

Timeline for d5nqqa1:

  • d5nqqa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08