Lineage for d5vyvb2 (5vyv B:85-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984340Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry)
  8. 1984344Domain d5vyvb2: 5vyv B:85-173 [335238]
    automated match to d3bz6a2
    complexed with peg

Details for d5vyvb2

PDB Entry: 5vyv (more details), 2.48 Å

PDB Description: crystal structure of a protein of unknown function yceh/eck1052 involved in membrane biogenesis from escherichia coli
PDB Compounds: (B:) UPF0502 protein YceH

SCOPe Domain Sequences for d5vyvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vyvb2 a.4.5.0 (B:85-173) automated matches {Escherichia coli [TaxId: 83334]}
fcnsefgdlklsaaevalittlllrgaqtpgelrsraarmyefsdmaeveltleqlanre
dgpfvvrlarepgkresrymhlfsgeved

SCOPe Domain Coordinates for d5vyvb2:

Click to download the PDB-style file with coordinates for d5vyvb2.
(The format of our PDB-style files is described here.)

Timeline for d5vyvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vyvb1