Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry) |
Domain d5vyvb2: 5vyv B:85-173 [335238] automated match to d3bz6a2 complexed with peg |
PDB Entry: 5vyv (more details), 2.48 Å
SCOPe Domain Sequences for d5vyvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vyvb2 a.4.5.0 (B:85-173) automated matches {Escherichia coli [TaxId: 83334]} fcnsefgdlklsaaevalittlllrgaqtpgelrsraarmyefsdmaeveltleqlanre dgpfvvrlarepgkresrymhlfsgeved
Timeline for d5vyvb2: