SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vyvb1 (5vyv B:1-84)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 2291933Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry)
  8. 2291936Domain d5vyvb1: 5vyv B:1-84 [335237]
    automated match to d3bz6a1
    complexed with peg

Details for d5vyvb1

PDB Entry: 5vyv (more details), 2.48 Å

PDB Description: crystal structure of a protein of unknown function yceh/eck1052 involved in membrane biogenesis from escherichia coli
PDB Compounds: (B:) UPF0502 protein YceH

SCOPe Domain Sequences for d5vyvb1:

Sequence, based on SEQRES records: (download)

>d5vyvb1 a.4.5.0 (B:1-84) automated matches {Escherichia coli [TaxId: 83334]}
mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
nlvkrhylrtvsgfgnrvtkyeqr

Sequence, based on observed residues (ATOM records): (download)

>d5vyvb1 a.4.5.0 (B:1-84) automated matches {Escherichia coli [TaxId: 83334]}
mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
nlvkrhylrtvsgrvtkyeqr

SCOPe Domain Coordinates for d5vyvb1:

Click to download the PDB-style file with coordinates for d5vyvb1.
(The format of our PDB-style files is described here.)

Timeline for d5vyvb1:

  • d5vyvb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5vyvb2