SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vyva2 (5vyv A:85-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 2291933Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry)
  8. 2291935Domain d5vyva2: 5vyv A:85-173 [335236]
    automated match to d3bz6a2
    complexed with peg

Details for d5vyva2

PDB Entry: 5vyv (more details), 2.48 Å

PDB Description: crystal structure of a protein of unknown function yceh/eck1052 involved in membrane biogenesis from escherichia coli
PDB Compounds: (A:) UPF0502 protein YceH

SCOPe Domain Sequences for d5vyva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vyva2 a.4.5.0 (A:85-173) automated matches {Escherichia coli [TaxId: 83334]}
fcnsefgdlklsaaevalittlllrgaqtpgelrsraarmyefsdmaeveltleqlanre
dgpfvvrlarepgkresrymhlfsgeved

SCOPe Domain Coordinates for d5vyva2:

Click to download the PDB-style file with coordinates for d5vyva2.
(The format of our PDB-style files is described here.)

Timeline for d5vyva2:

  • d5vyva2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5vyva1