SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wqra_ (5wqr A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2233900Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2233901Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2233902Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2233903Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2233939Species Thermochromatium tepidum [TaxId:1050] [57660] (8 PDB entries)
  8. 2291932Domain d5wqra_: 5wqr A: [335233]
    automated match to d1iuaa_
    complexed with gol, sf4, so4

Details for d5wqra_

PDB Entry: 5wqr (more details), 0.8 Å

PDB Description: high resolution structure of high-potential iron-sulfur protein in the reduced state
PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d5wqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wqra_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

SCOPe Domain Coordinates for d5wqra_:

Click to download the PDB-style file with coordinates for d5wqra_.
(The format of our PDB-style files is described here.)

Timeline for d5wqra_:

  • d5wqra_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08