SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vn6b_ (5vn6 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2291927Species Burkholderia ambifaria [TaxId:398577] [335228] (1 PDB entry)
  8. 2291928Domain d5vn6b_: 5vn6 B: [335229]
    automated match to d1otjb_
    complexed with mg

Details for d5vn6b_

PDB Entry: 5vn6 (more details), 2.1 Å

PDB Description: crystal structure of taurine dioxygenase from burkholderia ambifaria
PDB Compounds: (B:) Taurine dioxygenase

SCOPe Domain Sequences for d5vn6b_:

Sequence, based on SEQRES records: (download)

>d5vn6b_ b.82.2.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mrvepltcaigaellgvnladavhddglfaeirtqllrhrvlflrdqditraehvafarr
fgeledhpvagsdpehpglvriykspdqpndryenawhsdaswrvappfgcvlrcidgpp
vggdtmwanmvlayenlpdhvkqqiadlrarhsieasfgaampidkrlalkaqypdaehp
vvrthpetgekvlyvnaftthftnfhtparvrvgqdanpgagqllhyligqaaipeyqvr
wrwkknsvaiwdnratqhyavmdyppcvrrmeragivgdvpf

Sequence, based on observed residues (ATOM records): (download)

>d5vn6b_ b.82.2.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mrvepltcaigaellgvnladavhddglfaeirtqllrhrvlflrdqditraehvafarr
fgeledhehpglvriykryenawhsdaswrvappfgcvlrcidgppvggdtmwanmvlay
enlpdhvkqqiadlrarhsieasfgaampidkrlalkaqypdaehpvvrthpetgekvly
vnaftthftnfhtparvrvgqdanpgagqllhyligqaaipeyqvrwrwkknsvaiwdnr
atqhyavmdyppcvrrmeragivgdvpf

SCOPe Domain Coordinates for d5vn6b_:

Click to download the PDB-style file with coordinates for d5vn6b_.
(The format of our PDB-style files is described here.)

Timeline for d5vn6b_:

  • d5vn6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08