Lineage for d5vn6b_ (5vn6 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2291927Species Burkholderia ambifaria [TaxId:398577] [335228] (1 PDB entry)
  8. 2291928Domain d5vn6b_: 5vn6 B: [335229]
    automated match to d1otjb_
    complexed with mg

Details for d5vn6b_

PDB Entry: 5vn6 (more details), 2.1 Å

PDB Description: crystal structure of taurine dioxygenase from burkholderia ambifaria
PDB Compounds: (B:) Taurine dioxygenase

SCOPe Domain Sequences for d5vn6b_:

Sequence, based on SEQRES records: (download)

>d5vn6b_ b.82.2.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mrvepltcaigaellgvnladavhddglfaeirtqllrhrvlflrdqditraehvafarr
fgeledhpvagsdpehpglvriykspdqpndryenawhsdaswrvappfgcvlrcidgpp
vggdtmwanmvlayenlpdhvkqqiadlrarhsieasfgaampidkrlalkaqypdaehp
vvrthpetgekvlyvnaftthftnfhtparvrvgqdanpgagqllhyligqaaipeyqvr
wrwkknsvaiwdnratqhyavmdyppcvrrmeragivgdvpf

Sequence, based on observed residues (ATOM records): (download)

>d5vn6b_ b.82.2.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mrvepltcaigaellgvnladavhddglfaeirtqllrhrvlflrdqditraehvafarr
fgeledhehpglvriykryenawhsdaswrvappfgcvlrcidgppvggdtmwanmvlay
enlpdhvkqqiadlrarhsieasfgaampidkrlalkaqypdaehpvvrthpetgekvly
vnaftthftnfhtparvrvgqdanpgagqllhyligqaaipeyqvrwrwkknsvaiwdnr
atqhyavmdyppcvrrmeragivgdvpf

SCOPe Domain Coordinates for d5vn6b_:

Click to download the PDB-style file with coordinates for d5vn6b_.
(The format of our PDB-style files is described here.)

Timeline for d5vn6b_:

  • d5vn6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08