SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t7ea_ (5t7e A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (40 species)
    not a true protein
  7. 2291811Species Streptomyces hygroscopicus [TaxId:1912] [335112] (2 PDB entries)
  8. 2291924Domain d5t7ea_: 5t7e A: [335225]
    automated match to d1yr0a1
    complexed with bng, coa, ppq

Details for d5t7ea_

PDB Entry: 5t7e (more details), 1.8 Å

PDB Description: crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin
PDB Compounds: (A:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5t7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ea_ d.108.1.0 (A:) automated matches {Streptomyces hygroscopicus [TaxId: 1912]}
adirrateadmpavctivnhyietstvnfrtepqepqewtddlvrlrerypwlvaevdge
vagiayagpwkarnaydwtaestvyvsprhqrtglgstlythllksleaqgfksvvavig
lpndpsvrmhealgyaprgmlraagfkhgnwhdvgfwqldfslpvpprpvlpvt

SCOPe Domain Coordinates for d5t7ea_:

Click to download the PDB-style file with coordinates for d5t7ea_.
(The format of our PDB-style files is described here.)

Timeline for d5t7ea_:

  • d5t7ea_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08