Lineage for d5thla_ (5thl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105572Species Human (Homo sapiens) [TaxId:9606] [82355] (6 PDB entries)
  8. 2291906Domain d5thla_: 5thl A: [335207]
    automated match to d1n3la_
    mutant

Details for d5thla_

PDB Entry: 5thl (more details), 1.6 Å

PDB Description: crystal structure of the human tyrosyl-trna synthetase mutant g41r
PDB Compounds: (A:) Tyrosine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d5thla_:

Sequence, based on SEQRES records: (download)

>d5thla_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywrtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskmssseeeskidlldrkedvkk
klkkafcepgnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaev
vhpgdlknsvevalnklldpirekfntpalkklasaayp

Sequence, based on observed residues (ATOM records): (download)

>d5thla_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywrtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskidlldrkedvkkklkkafcep
gnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaevvhpgdlkns
vevalnklldpirekfntpalkklasaayp

SCOPe Domain Coordinates for d5thla_:

Click to download the PDB-style file with coordinates for d5thla_.
(The format of our PDB-style files is described here.)

Timeline for d5thla_:

  • d5thla_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08