SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thla_ (5thl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105572Species Human (Homo sapiens) [TaxId:9606] [82355] (6 PDB entries)
  8. 2291906Domain d5thla_: 5thl A: [335207]
    automated match to d1n3la_
    mutant

Details for d5thla_

PDB Entry: 5thl (more details), 1.6 Å

PDB Description: crystal structure of the human tyrosyl-trna synthetase mutant g41r
PDB Compounds: (A:) Tyrosine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d5thla_:

Sequence, based on SEQRES records: (download)

>d5thla_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywrtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskmssseeeskidlldrkedvkk
klkkafcepgnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaev
vhpgdlknsvevalnklldpirekfntpalkklasaayp

Sequence, based on observed residues (ATOM records): (download)

>d5thla_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywrtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskidlldrkedvkkklkkafcep
gnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaevvhpgdlkns
vevalnklldpirekfntpalkklasaayp

SCOPe Domain Coordinates for d5thla_:

Click to download the PDB-style file with coordinates for d5thla_.
(The format of our PDB-style files is described here.)

Timeline for d5thla_:

  • d5thla_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08