SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ulfa1 (5ulf A:1-147)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164354Species Human (Homo sapiens) [TaxId:9606] [186848] (44 PDB entries)
  8. 2291897Domain d5ulfa1: 5ulf A:1-147 [335198]
    Other proteins in same PDB: d5ulfa2, d5ulfb_, d5ulfc2, d5ulfd_
    automated match to d2clwa_
    complexed with gol

Details for d5ulfa1

PDB Entry: 5ulf (more details), 1.8 Å

PDB Description: crystal structure of a ubch5b~ub conjugate
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5ulfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulfa1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5ulfa1:

Click to download the PDB-style file with coordinates for d5ulfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ulfa1:

  • d5ulfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08