SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gjka_ (5gjk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982024Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982025Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982060Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)
  8. 2291896Domain d5gjka_: 5gjk A: [335197]
    automated match to d2fq3a1
    complexed with gol, po4

Details for d5gjka_

PDB Entry: 5gjk (more details), 2.05 Å

PDB Description: crystal structure of baf47 and baf155 complex
PDB Compounds: (A:) SWI/SNF complex subunit SMARCC1

SCOPe Domain Sequences for d5gjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjka_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhiiipsyaswfdyncihvierralpeffngknksktpeiylayrnfmidtyrlnpqeyl
tstacrrnltgdvcavmrvhafleqwglvnyqvd

SCOPe Domain Coordinates for d5gjka_:

Click to download the PDB-style file with coordinates for d5gjka_.
(The format of our PDB-style files is described here.)

Timeline for d5gjka_:

  • d5gjka_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08