SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vaaa2 (5vaa A:342-443)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (562 PDB entries)
  8. 2291894Domain d5vaaa2: 5vaa A:342-443 [335195]
    automated match to d1igyb4
    complexed with bma, fuc, gal, gol, man, mes, nag; mutant

Details for d5vaaa2

PDB Entry: 5vaa (more details), 1.55 Å

PDB Description: crystal structure of mouse igg2a fc t370k mutant
PDB Compounds: (A:) ig gamma-2a chain c region, a allele

SCOPe Domain Sequences for d5vaaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vaaa2 b.1.1.0 (A:342-443) automated matches {Mus musculus [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvkdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOPe Domain Coordinates for d5vaaa2:

Click to download the PDB-style file with coordinates for d5vaaa2.
(The format of our PDB-style files is described here.)

Timeline for d5vaaa2:

  • d5vaaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5vaaa1