SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nqqc2 (5nqq C:160-331)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2206815Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 protein domains)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2207162Protein automated matches [226882] (7 species)
    not a true protein
  7. 2207285Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (8 PDB entries)
  8. 2291893Domain d5nqqc2: 5nqq C:160-331 [335194]
    Other proteins in same PDB: d5nqqa1, d5nqqb1, d5nqqc1, d5nqqd1
    automated match to d4i9ha2
    complexed with nai, oaa, so4

Details for d5nqqc2

PDB Entry: 5nqq (more details), 1.87 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqqc2 d.162.1.1 (C:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5nqqc2:

Click to download the PDB-style file with coordinates for d5nqqc2.
(The format of our PDB-style files is described here.)

Timeline for d5nqqc2:

  • d5nqqc2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08