Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (5 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (8 PDB entries) |
Domain d5nqqc1: 5nqq C:1-159 [335193] Other proteins in same PDB: d5nqqa2, d5nqqb2, d5nqqc2, d5nqqd2 automated match to d4i9ha1 complexed with nai, oaa, so4 |
PDB Entry: 5nqq (more details), 1.87 Å
SCOPe Domain Sequences for d5nqqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nqqc1 c.2.1.5 (C:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d5nqqc1: