SCOPe 2.06: Domain d5nqqc1: 5nqq C:1-159

Lineage for d5nqqc1 (5nqq C:1-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (8 PDB entries)

8. Domain d5nqqc1: 5nqq C:1-159 [335193]
   Other proteins in same PDB: d5nqqa2, d5nqqb2, d5nqqc2, d5nqqd2
   automated match to d4i9ha1
   complexed with nai, oaa, so4

Details for d5nqqc1

PDB Entry: 5nqq, 1.87 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqqc1:

Sequence; same for both SEQRES and ATOM records:

>d5nqqc1 c.2.1.5 (C:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d5nqqc1:

• d5nqqc1 is new in SCOPe 2.06-stable
  
• d5nqqc1 appears in SCOPe 2.07
  
• d5nqqc1 appears in the current release, SCOPe 2.08