SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nqqc1 (5nqq C:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093432Protein automated matches [226881] (5 species)
    not a true protein
  7. 2093485Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (8 PDB entries)
  8. 2291892Domain d5nqqc1: 5nqq C:1-159 [335193]
    Other proteins in same PDB: d5nqqa2, d5nqqb2, d5nqqc2, d5nqqd2
    automated match to d4i9ha1
    complexed with nai, oaa, so4

Details for d5nqqc1

PDB Entry: 5nqq (more details), 1.87 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqqc1 c.2.1.5 (C:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5nqqc1:

Click to download the PDB-style file with coordinates for d5nqqc1.
(The format of our PDB-style files is described here.)

Timeline for d5nqqc1:

  • d5nqqc1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08