SCOPe 2.06: Domain d5vaaa1: 5vaa A:237-341

Lineage for d5vaaa1 (5vaa A:237-341)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5vaaa1: 5vaa A:237-341 [335192]
   automated match to d1igyb3
   complexed with bma, fuc, gal, gol, man, mes, nag; mutant

Details for d5vaaa1

PDB Entry: 5vaa, 1.55 Å

PDB Description: crystal structure of mouse igg2a fc t370k mutant

PDB Compounds: (A:) ig gamma-2a chain c region, a allele

SCOPe Domain Sequences for d5vaaa1:

Sequence; same for both SEQRES and ATOM records:

>d5vaaa1 b.1.1.0 (A:237-341) automated matches {Mus musculus [TaxId: 10090]}
gpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
nstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkg

Timeline for d5vaaa1:

• d5vaaa1 is new in SCOPe 2.06-stable
  
• d5vaaa1 appears in SCOPe 2.07
  
• d5vaaa1 appears in the current release, SCOPe 2.08