Lineage for d5v4ld_ (5v4l D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (19 species)
    not a true protein
  7. 2291887Species Cryptococcus neoformans [TaxId:5207] [335188] (1 PDB entry)
  8. 2291888Domain d5v4ld_: 5v4l D: [335189]
    automated match to d2vd6b_

Details for d5v4ld_

PDB Entry: 5v4l (more details), 2.1 Å

PDB Description: cryptococcus neoformans adenylosuccinate lyase
PDB Compounds: (D:) adenylosuccinate lyase

SCOPe Domain Sequences for d5v4ld_:

Sequence, based on SEQRES records: (download)

>d5v4ld_ a.127.1.0 (D:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
mdsyqtplssryaskemsklfssgarfgtwrklwlnlaiaekelglaisdaaieqmkanl
eldeaqmkvaaeeekkrrhdvmahvhtfgtvapeaagiihlgatscyvtdnadliflrdg
ldillpklatvisrlanfakqyrdlptlgfthfqpaqlttvgkratlwiqellwdlrnlq
rarddlgfrgvkgttgtqasflalfdgdhakvealdkrvtelfgfpyaypvtgqtysrki
dadvlgplssfgatvhkiatdirllanlkeieepfekdqigssamaykrnpmrceracsl
arhlmaiyqntlmtssvqwlertlddsanrrvtipeafltadillttlqniseglvvypr
vigrrisqelpfmateniimaivkaggdrqechekirvlshqagavvkeeggendlidrv
kndeyfkpiwgqldalldprtfvgrapeqvdgflkewvepalkpyeea

Sequence, based on observed residues (ATOM records): (download)

>d5v4ld_ a.127.1.0 (D:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
mdsyqtplssskemsklfssgarfgtwrklwlnlaiaekelglaisdaaieqmkanleld
eaqmkvaaeeehdvmahvhtfgtvapeaagiihlgatscyvtdnadliflrdgldillpk
latvisrlanfakqyrdlptlgfthfqpaqlttvgkratlwiqellwdlrnlqrarddlg
frgvkgttgtqasflalfdgdhakvealdkrvtelfgfpyaypvtgqtysrkidadvlgp
lssfgatvhkiatdirllanlkeieepfaykrnpmrceracslarhlmaiyqntlmtssv
qwlertlddsanrrvtipeafltadillttlqniseglvvyprvigrrisqelpfmaten
iimaivkaggdrqechekirvlshqagavvkeeggendlidrvkndeyfkpiwgqldall
dprtfvgrapeqvdgflkewvepalkpyeea

SCOPe Domain Coordinates for d5v4ld_:

Click to download the PDB-style file with coordinates for d5v4ld_.
(The format of our PDB-style files is described here.)

Timeline for d5v4ld_:

  • d5v4ld_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08