Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Cryptococcus neoformans [TaxId:235443] [335068] (1 PDB entry) |
Domain d5jy5a1: 5jy5 A:2-104 [335185] Other proteins in same PDB: d5jy5a2, d5jy5b2 automated match to d1syra_ complexed with gol, so4, trs |
PDB Entry: 5jy5 (more details), 1.8 Å
SCOPe Domain Sequences for d5jy5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jy5a1 c.47.1.0 (A:2-104) automated matches {Cryptococcus neoformans [TaxId: 235443]} vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe diakeaqikamptfvaykdgkvietvtgavpakinalldkvaa
Timeline for d5jy5a1: