SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jy5a1 (5jy5 A:2-104)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (163 species)
    not a true protein
  7. 2291767Species Cryptococcus neoformans [TaxId:235443] [335068] (1 PDB entry)
  8. 2291884Domain d5jy5a1: 5jy5 A:2-104 [335185]
    Other proteins in same PDB: d5jy5a2, d5jy5b2
    automated match to d1syra_
    complexed with gol, so4, trs

Details for d5jy5a1

PDB Entry: 5jy5 (more details), 1.8 Å

PDB Description: crystal structure of thioredoxin 1 from cryptococcus neoformans at 1.8 angstroms resolution
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5jy5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jy5a1 c.47.1.0 (A:2-104) automated matches {Cryptococcus neoformans [TaxId: 235443]}
vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe
diakeaqikamptfvaykdgkvietvtgavpakinalldkvaa

SCOPe Domain Coordinates for d5jy5a1:

Click to download the PDB-style file with coordinates for d5jy5a1.
(The format of our PDB-style files is described here.)

Timeline for d5jy5a1:

  • d5jy5a1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5jy5a2